M65 trifluoroacetate salt,CAS :1872440-65-7
M65 trifluoroacetate salt
Catalog # | Pkg Size | Price(USD) | Quantity | Buy this product |
---|---|---|---|---|
R-M-914 | 0.5mg | 310.00 | + Add to cart |
|
R-M-914 | 1mg | 580.00 | + Add to cart |
|
|
Product description
M65 trifluoroacetate salt is a Potent and specific PAC1 receptor antagonist.
Appearance | N/A |
---|---|
Molecular weight | N/A |
Purity | >90% |
Solubility | N/A |
Cas | 1872440-65-7 |
Sequence | CDATCQFRKAIDDCQKQAHHSNVPGNSVFKECMKQKKEFKA-NH₂ |
Synonyms | PAC1 Receptor Antagonist M65 |
Molecular Formula | C₂₀₅H₃₂₆N₆₄O₆₁S₅ |
Storage | -20℃, protected from light and moisture |
Transportation | 4-25℃ temperature for up to 3 weeks |
Stability | 1 year |
Document
Related Product